PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G16870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 456aa    MW: 49743.6 Da    PI: 6.2957
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G16870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-152469146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W++eEde l + v+ +G++ W++I +++g+ Rt+k+c++rw +
  LPERR04G16870.1 24 KGPWSEEEDEVLREHVRTHGPREWSSIRSKVGLPRTGKSCRLRWVN 69
                     79******************************99**********87 PP

2Myb_DNA-binding39.61.2e-1279119345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+ E+   +++ +++G++ W++Ia +++ gRt++++k++w 
  LPERR04G16870.1  79 KFTANEEREVIELQARYGNK-WARIATHLQ-GRTDNDVKNFWS 119
                      79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.491975IPR017930Myb domain
SuperFamilySSF466891.25E-2622118IPR009057Homeodomain-like
SMARTSM007179.0E-152373IPR001005SANT/Myb domain
PfamPF002498.4E-142469IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-212578IPR009057Homeodomain-like
CDDcd001672.89E-122671No hitNo description
SMARTSM007174.3E-1176124IPR001005SANT/Myb domain
PROSITE profilePS5129417.12276126IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-1879124IPR009057Homeodomain-like
PfamPF002491.6E-1179119IPR001005SANT/Myb domain
CDDcd001673.25E-979118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MAPAPGGVRG RGGGRGGGEE EVRKGPWSEE EDEVLREHVR THGPREWSSI RSKVGLPRTG  60
KSCRLRWVNK LRPNLKSCKF TANEEREVIE LQARYGNKWA RIATHLQGRT DNDVKNFWST  120
RQKRLARLLR VPLCARSKKQ KNSSRGKALA SFPKSEAEPE TAMVHQGSAC LNQASLEGNS  180
SYCQYSEAAP FVKYQNVAQA PYDQACAGSF AFKGALPPLA AGEGSSSAAG EVSSSNAAQL  240
APLMLFDHPA YPRRLLRTPV NAWSDTEKNS NKGKEPSSSL ESETAMIHQD PTYPDQASFE  300
GYSFGCQCYE DELYVDYWNA AQAHDPAWSG SFSFEGAQEL PQQLLPPAAG EASSSSAAQF  360
APPLPFDHPG YPLINFPGVS HALVGAMNDL TFHEMLPMMQ SAPMIVPFVC MEFAHGAVKD  420
EPRDAFNDLP PVMSNDTVDQ LPPAPPPSPA SSGDEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-262112424126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6630002e-42AL663000.4 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0034G17, complete sequence.
GenBankAL7316132e-42AL731613.5 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0065H10, complete sequence.
GenBankAP0149602e-42AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126122e-42CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552182e-42CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692198.11e-100PREDICTED: uncharacterized protein LOC102701723
TrEMBLA0A0D9W7V70.0A0A0D9W7V7_9ORYZ; Uncharacterized protein
STRINGOB04G27810.11e-101(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-53MYB family protein